Specifications
Chemical Name: Thymosin β4 (timbetasin)
Synonyms: TB-500; Tβ4; timbetasin
Molecular Formula: C212H350N56O78S
Molecular Weight: ≈ 4,963.5 g/mol
Physical Appearance: White to off-white lyophilized powder
Sequence (1-letter): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa)
Container: 3 mL glass vial (10 mg net content)
Purity: ≥99% verified by HPLC & MS (lot COA via QR)
Intended Use: Laboratory research only (RUO). Not for human or animal consumption.
Description
What does TB-500 do?
In preclinical and laboratory research, TB-500 is primarily studied for its interaction with actin, a structural protein essential for cell movement and organization. By influencing actin dynamics, TB-500 supports cellular processes related to migration, repair signaling, and tissue restructuring.
One of the key areas of interest surrounding TB-500 is its role in angiogenic signaling and tissue recovery pathways. Research models suggest that by supporting coordinated cell movement and vascular response mechanisms, TB-500 contributes to conditions favorable for tissue repair and regeneration studies.
TB-500 has also been evaluated in experimental research involving:
• Cellular migration and differentiation
• Vascular remodeling and angiogenic pathways
• Connective tissue and musculoskeletal research models
• Cytoskeletal organization and repair signaling
Its systemic activity and broad signaling profile distinguish TB-500 from more localized research peptides.
Research Context
TB-500 is studied exclusively in controlled laboratory and educational research settings. Researchers value its reproducible signaling behavior in models focused on cell motility, tissue architecture, and recovery-associated biological pathways.
Because it is derived from a naturally occurring protein fragment with wide biological relevance, TB-500 is often examined alongside other repair-oriented peptides in mechanistic and exploratory research frameworks.
All referenced effects are based on preclinical and laboratory research only.
Storage & Handling
Storage Before Reconstitution (Lyophilized Peptide)
Unreconstituted (lyophilized) peptides should be stored cold and dry to prevent degradation.
• Short-term storage: 2°C–8°C (36°F–46°F) — standard laboratory refrigeration
• Long-term storage: –20°C (–4°F) or colder
Storage After Reconstitution
Once reconstituted, peptides become more sensitive to temperature, light, and contamination.
• Refrigerated storage: 2°C–8°C (36°F–46°F) for short-term research use
• Frozen storage (if required by protocol): –20°C (–4°F)
Handling best practices:
• Avoid repeated temperature changes.
• Minimize vial access and unnecessary agitation
• Keep protected from light
Return Policy
Due to the nature of our products, all sales are final. We do not accept returns, exchanges, or refunds once an order has been shipped.
Terms & Conditions of Use
By accessing this website or purchasing any product from Pure Source Peptide, you agree to the following Terms & Conditions of Use.
Research Use Only (RUO)
All products sold on this website are designated Research Use Only (RUO). Products are supplied solely for laboratory and educational research purposes and are not intended for human or animal consumption. These products are not approved by the U.S. Food and Drug Administration (FDA) for diagnostic, therapeutic, medical, dietary, or veterinary use and have not undergone clinical evaluation for safety or efficacy.
Eligibility to Purchase
By placing an order, you confirm that:
• You are at least 21 years of age
• You are a qualified professional, institution, or individual conducting legitimate research
• You possess the appropriate knowledge, facilities, and equipment to handle research chemicals safely and responsibly
Prohibited Use
You agree not to use, distribute, resell, or represent any product purchased from this website:
• For human or animal use
• For diagnostic, therapeutic, or medical purposes
• As a dietary supplement, drug, cosmetic, or household product
• In violation of any local, state, federal, or international laws or regulations
Any misuse of products assumes all associated risk and voids any eligibility for claims or support.